TA344965 YTHDF1 antibody

Rabbit Polyclonal Anti-YTHDF1 Antibody - middle region

See related secondary antibodies

Search for all "YTHDF1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat YTHDF1

Product Description for YTHDF1

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat YTHDF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for YTHDF1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C20orf21, YTH domain family protein 1
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BYJ9
Immunogen:
The immunogen for anti-YTHDF1 antibody: synthetic peptide directed towards the middle region of human YTHDF1. Synthetic peptide located within the following region: QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA.
GeneID:
54915
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for YTHDF1 (3 products)

Catalog No. Species Pres. Purity   Source  

YTHDF1

YTHDF1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

YTHDF1

YTHDF1 Human Purified
  Abnova Taiwan Corp.

YTHDF1

YTHDF1 Human Purified
  Abnova Taiwan Corp.

Positive controls for YTHDF1 (2 products)

Catalog No. Species Pres. Purity   Source  

YTHD1 Lysate

Western Blot: YTHD1 Lysate [NBL1-17943] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for YTHDF1
  Novus Biologicals Inc.

YTHDF1 overexpression lysate

YTHDF1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn