TA344969 TTC27 antibody

Rabbit Polyclonal Anti-TTC27 Antibody - N-terminal region

See related secondary antibodies

Search for all "TTC27"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TTC27

Product Description for TTC27

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TTC27.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TTC27

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms TPR repeat protein 27, Tetratricopeptide repeat protein 27
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P3X3
Immunogen:
The immunogen for anti-TTC27 antibody: synthetic peptide directed towards the N terminal of human TTC27. Synthetic peptide located within the following region: KDQLDIAKDISQLQIDLTGALGKRTRFQENYVAQLILDVRREGDVLSNCE.
GeneID:
55622
Application WB
Background The function of TTC27 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TTC27 (1 products)

Catalog No. Species Pres. Purity   Source  

TTC27

TTC27 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for TTC27 (3 products)

Catalog No. Species Pres. Purity   Source  

TTC27 293T Cell Transient Overexpression Lysate(Denatured)

TTC27 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TTC27 Lysate

Western Blot: TTC27 Lysate [NBL1-17403] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TTC27
  Novus Biologicals Inc.

TTC27 overexpression lysate

TTC27 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn