TA344974 BIVM antibody

Rabbit Polyclonal Anti-BIVM Antibody - middle region

See related secondary antibodies

Search for all "BIVM"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Porcine BIVM

Product Description for BIVM

Rabbit anti Human, Mouse, Porcine BIVM.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BIVM

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Basic immunoglobulin-like variable motif-containing protein
Presentation Purified
Reactivity Hu, Ms, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86UB2
Immunogen:
The immunogen for anti-BIVM antibody: synthetic peptide directed towards the middle region of human BIVM. Synthetic peptide located within the following region: PFGTIRQESQPPTHAQGIAKSESEDNISKKQHGRLGRSFSASFHQDSAWK.
GeneID:
54841
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for BIVM (1 products)

Catalog No. Species Pres. Purity   Source  

BIVM overexpression lysate

BIVM overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn