TA344977 LRRC49 antibody

Rabbit Polyclonal Anti-LRRC49 Antibody - N-terminal region

See related secondary antibodies

Search for all "LRRC49"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat LRRC49

Product Description for LRRC49

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat LRRC49.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LRRC49

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Leucine-rich repeat-containing protein 49
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IUZ0
Immunogen:
The immunogen for anti-LRRC49 antibody: synthetic peptide directed towards the N terminal of human LRRC49. Synthetic peptide located within the following region: KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRS.
GeneID:
54839
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LRRC49 (2 products)

Catalog No. Species Pres. Purity   Source  

LRRC49

LRRC49 Human Purified
  Abnova Taiwan Corp.

LRRC49

LRRC49 Human Purified
  Abnova Taiwan Corp.

Positive controls for LRRC49 (1 products)

Catalog No. Species Pres. Purity   Source  

LRRC49 Lysate

Western Blot: LRRC49 Lysate [NBL1-12698] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LRRC49
  Novus Biologicals Inc.
  • LinkedIn