TA344979 GDAP2 antibody

Rabbit Polyclonal Anti-GDAP2 Antibody - N-terminal region

See related secondary antibodies

Search for all "GDAP2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish GDAP2

Product Description for GDAP2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish GDAP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GDAP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ganglioside-induced differentiation-associated protein 2
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NXN4
Immunogen:
The immunogen for anti-GDAP2 antibody: synthetic peptide directed towards the N terminal of human GDAP2. Synthetic peptide located within the following region: CRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLA.
GeneID:
54834
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GDAP2 (3 products)

Catalog No. Species Pres. Purity   Source  

GDAP2 (transcript variant 1)

GDAP2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GDAP2

GDAP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GDAP2

GDAP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for GDAP2 (1 products)

Catalog No. Species Pres. Purity   Source  

GDAP2 overexpression lysate

GDAP2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn