TA344981 Jouberin antibody

Rabbit Polyclonal Anti-AHI1 Antibody - C-terminal region

See related secondary antibodies

Search for all "Jouberin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Jouberin

Product Description for Jouberin

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Jouberin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Jouberin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AHI-1, AHI1, Abelson helper integration site 1 protein homolog
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N157
Immunogen:
The immunogen for anti-Ahi1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KDSTLRIMDLRILAARKFVGAANYREKIHSTLTPCGTLLFSGSEDGIVYV.
GeneID:
54806
Application WB
Background Mutations in the human homolog are associated with Joubert syndrome, an autosomal recessive disorder resulting in severe mental retardation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Jouberin (3 products)

Catalog No. Species Pres. Purity   Source  

Jouberin

Jouberin Human Purified
  Abnova Taiwan Corp.

Jouberin

Jouberin Human
  Abnova Taiwan Corp.

Jouberin

Jouberin Human Purified
  Abnova Taiwan Corp.

Positive controls for Jouberin (1 products)

Catalog No. Species Pres. Purity   Source  

AHI1 293T Cell Transient Overexpression Lysate(Denatured)

AHI1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn