TA344982 HAUS6 antibody

Rabbit Polyclonal Anti-FAM29A Antibody - middle region

See related secondary antibodies

Search for all "HAUS6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human HAUS6

Product Description for HAUS6

Rabbit anti Human HAUS6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HAUS6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DGT6, FAM29A, HAUS augmin-like complex subunit 6, KIAA1574
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z4H7
Immunogen:
The immunogen for anti-FAM29A antibody: synthetic peptide directed towards the middle region of human FAM29A. Synthetic peptide located within the following region: RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT.
GeneID:
54801
Application WB
Background FAM29A is required for progression through mitosis. FAM29A promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-tubulin.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HAUS6 (3 products)

Catalog No. Species Pres. Purity   Source  

HAUS6

HAUS6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

HAUS6

HAUS6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

HAUS6

HAUS6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for HAUS6 (1 products)

Catalog No. Species Pres. Purity   Source  

HAUS6 overexpression lysate

HAUS6 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn