TA344992 MIER2 antibody

Rabbit Polyclonal Anti-MIER2 Antibody - middle region

See related secondary antibodies

Search for all "MIER2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MIER2

Product Description for MIER2

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MIER2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MIER2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1193, Mesoderm induction early response protein 2, Mi-er2
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N344
Immunogen:
The immunogen for anti-MIER2 antibody: synthetic peptide directed towards the middle region of human MIER2. Synthetic peptide located within the following region: RLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGE.
GeneID:
54531
Application WB
Background MIER2 is a transcriptiol repressor.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MIER2 (2 products)

Catalog No. Species Pres. Purity   Source  

MIER2

MIER2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MIER2

MIER2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for MIER2 (2 products)

Catalog No. Species Pres. Purity   Source  

MIER2 Lysate

Western Blot: MIER2 Lysate [NBL1-13106] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MIER2
  Novus Biologicals Inc.

MIER2 overexpression lysate

MIER2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn