TA344999 ENOSF1 / RTS antibody

Rabbit Polyclonal Anti-ENOSF1 Antibody - middle region

See related secondary antibodies

Search for all "ENOSF1 / RTS"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ENOSF1 / RTS

Product Description for ENOSF1 / RTS

Rabbit anti Human ENOSF1 / RTS.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ENOSF1 / RTS

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Antisense RNA to thymidylate synthase, Mitochondrial enolase superfamily member 1, TYMSAS
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7L5Y1
Immunogen:
The immunogen for Anti-ENOSF1 antibody is: synthetic peptide directed towards the middle region of Human ENOSF1. Synthetic peptide located within the following region: LMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTSPDDILGHATISKALVP.
GeneID:
55556
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ENOSF1 / RTS (1 products)

Catalog No. Species Pres. Purity   Source  

ENOSF1 overexpression lysate

ENOSF1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn