TA345004 Proline-rich protein 16 / PRR16 antibody

Rabbit Polyclonal Anti-PRR16 Antibody - middle region

See related secondary antibodies

Search for all "Proline-rich protein 16 / PRR16"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat Proline-rich protein 16 / PRR16

Product Description for Proline-rich protein 16 / PRR16

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat Proline-rich protein 16 / PRR16.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Proline-rich protein 16 / PRR16

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LOC51334, Mesenchymal stem cell protein DSC54
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q569H4-3
Immunogen:
The immunogen for anti-PRR16 antibody: synthetic peptide directed towards the middle region of human PRR16. Synthetic peptide located within the following region: RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPL.
GeneID:
51334
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn