TA345006 KRCC1 / CHBP2 antibody

Rabbit Polyclonal Anti-KRCC1 Antibody - N-terminal region

See related secondary antibodies

Search for all "KRCC1 / CHBP2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human KRCC1 / CHBP2

TA345006

More Views

  • TA345006

Product Description for KRCC1 / CHBP2

Rabbit anti Equine, Human KRCC1 / CHBP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KRCC1 / CHBP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Lysine-rich coiled-coil protein 1
Presentation Purified
Reactivity Eq, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NPI7
Immunogen:
The immunogen for anti-KRCC1 antibody: synthetic peptide directed towards the N terminal of human KRCC1. Synthetic peptide located within the following region: KMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENR.
GeneID:
51315
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for KRCC1 / CHBP2 (1 products)

Catalog No. Species Pres. Purity   Source  

Lysine-rich coiled-coil 1 Lysate

Western Blot: Lysine-rich coiled-coil 1 Lysate [NBL1-12377] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for KRCC1.
  Novus Biologicals Inc.
  • LinkedIn