TA345009 RASL12 / RIS antibody

Rabbit Polyclonal Anti-RASL12 Antibody - N-terminal region

See related secondary antibodies

Search for all "RASL12 / RIS"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Porcine, Rat RASL12 / RIS

Product Description for RASL12 / RIS

Rabbit anti Human, Mouse, Porcine, Rat RASL12 / RIS.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RASL12 / RIS

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ras-like protein Ris, Ras-like protein family member 12
Presentation Purified
Reactivity Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NYN1
Immunogen:
The immunogen for anti-RASL12 antibody: synthetic peptide directed towards the N terminal of human RASL12. Synthetic peptide located within the following region: MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKFLTKRFISEYD.
GeneID:
51285
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RASL12 / RIS (4 products)

Catalog No. Species Pres. Purity   Source  

RASL12 / RIS (1-266, His-tag)

RASL12 / RIS Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

RASL12 / RIS (1-266, His-tag)

RASL12 / RIS Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

RASL12 / RIS

RASL12 / RIS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RASL12 / RIS

RASL12 / RIS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RASL12 / RIS (3 products)

Catalog No. Species Pres. Purity   Source  

RASL12 293T Cell Transient Overexpression Lysate(Denatured)

RASL12 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RASL12 293T Cell Transient Overexpression Lysate(Denatured)

RASL12 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RASL12 Lysate

Western Blot: RASL12 Lysate [NBL1-15175] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RASL12
  Novus Biologicals Inc.
  • LinkedIn