TA345011 IER5 antibody

Rabbit Polyclonal Anti-IER5 Antibody - N-terminal region

See related secondary antibodies

Search for all "IER5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Rat, Zebrafish IER5

Product Description for IER5

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Rat, Zebrafish IER5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IER5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Immediate early response gene 5 protein, PP4583, SBBI48
Presentation Purified
Reactivity Bov, GP, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VY09
Immunogen:
The immunogen for anti-IER5 antibody: synthetic peptide directed towards the N terminal of human IER5. Synthetic peptide located within the following region: MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD.
GeneID:
51278
Application WB
Background This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic sigls. Studies in rats found the expression of a similar gene
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IER5 (4 products)

Catalog No. Species Pres. Purity   Source  

IER5

IER5 Human Purified
  Abnova Taiwan Corp.

IER5

IER5 Human Purified
  Abnova Taiwan Corp.

IER5

IER5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IER5

IER5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for IER5 (2 products)

Catalog No. Species Pres. Purity   Source  

IER5 293T Cell Transient Overexpression Lysate(Denatured)

IER5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

IER5 overexpression lysate

IER5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn