TA345014 CXorf26 antibody

Rabbit Polyclonal Anti-CXorf26 Antibody - middle region

See related secondary antibodies

Search for all "CXorf26"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Guinea Pig, Human, Porcine, Rabbit CXorf26

Product Description for CXorf26

Rabbit anti Equine, Guinea Pig, Human, Porcine, Rabbit CXorf26.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CXorf26

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms UPF0368 protein Cxorf26
Presentation Purified
Reactivity Eq, GP, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BVG4
Immunogen:
The immunogen for anti-CXorf26 antibody: synthetic peptide directed towards the middle region of human CXorf26. Synthetic peptide located within the following region: IYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTL.
GeneID:
51260
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CXorf26 (1 products)

Catalog No. Species Pres. Purity   Source  

CXorf26

CXorf26 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for CXorf26 (2 products)

Catalog No. Species Pres. Purity   Source  

CXorf26 Lysate

Western Blot: CXorf26 Lysate [NBL1-09639] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CXorf26
  Novus Biologicals Inc.

PBDC1 overexpression lysate

PBDC1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn