TA345019 VTA1 antibody

Rabbit Polyclonal Anti-VTA1 Antibody - N-terminal region

See related secondary antibodies

Search for all "VTA1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish VTA1

Product Description for VTA1

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish VTA1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for VTA1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C6orf55, DRG-1, Dopamine-responsive gene 1 protein, LIP5, LYST-interacting protein 5, SBP1, SKD1-binding protein 1, Vacuolar protein sorting-associated protein VTA1 homolog
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NP79
Immunogen:
The immunogen for anti-VTA1 antibody: synthetic peptide directed towards the N terminal of human VTA1. Synthetic peptide located within the following region: KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT.
GeneID:
51534
Application WB
Background C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al., 2005 [PubMed 15644320]).
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for VTA1 (5 products)

Catalog No. Species Pres. Purity   Source  

VTA1

VTA1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

VTA1 (1-307, His-tag)

VTA1 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

VTA1 (1-307, His-tag)

VTA1 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

VTA1

VTA1 Human
  Abnova Taiwan Corp.

VTA1

VTA1 Human
  Abnova Taiwan Corp.

Positive controls for VTA1 (2 products)

Catalog No. Species Pres. Purity   Source  

VTA1 Lysate

Western Blot: VTA1 Lysate [NBL1-17767] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for VTA1
  Novus Biologicals Inc.

VTA1 overexpression lysate

VTA1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn