TA345028 C11orf73 antibody

Rabbit Polyclonal Anti-C11orf73 Antibody - middle region

See related secondary antibodies

Search for all "C11orf73"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Porcine C11orf73

Product Description for C11orf73

Rabbit anti Canine, Porcine C11orf73.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C11orf73

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HSPC138, HSPC179, HSPC248, Uncharacterized protein C11orf73, chromosome 11 open reading frame 73
Presentation Purified
Reactivity Can, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q53FT3
Immunogen:
The immunogen for anti-C11orf73 antibody: synthetic peptide directed towards the middle region of human C11orf73. Synthetic peptide located within the following region: DNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK.
GeneID:
51501
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C11orf73 (1 products)

Catalog No. Species Pres. Purity   Source  

C11orf73 (transcript variant 1)

C11orf73 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for C11orf73 (2 products)

Catalog No. Species Pres. Purity   Source  

C11orf73 Lysate

Western Blot: C11orf73 Lysate [NBL1-08119] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for C11orf73. Protein
  Novus Biologicals Inc.

C11orf73 overexpression lysate

C11orf73 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn