RAB9B / RAB9L

Product Description for RAB9B / RAB9L

Rabbit anti Bovine, Canine, Human, Mouse, Rat RAB9B / RAB9L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	Rab-9-like protein, Rab-9B, Rab-9L, Ras-related protein Rab-9B
Presentation	Purified
Reactivity	Bov, Can, Hu, Ms, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Immunogen	Swiss Prot Num: Q9NP90 Immunogen: The immunogen for anti-RAB9B antibody: synthetic peptide directed towards the N terminal of human RAB9B. Synthetic peptide located within the following region: KSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERF. GeneID: 51209
Application	WB
Background	This gene encodes a member of a subfamily of RAS small guanosine triphosphate (GTP)-binding proteins that regulate membrane trafficking. The encoded protein may be involved in endosome-to-Golgi transport.
Format	Purification: Affinity Purified Buffer System: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Catalog No.	Species	Pres.	Purity	Source
TP310826	RAB9B / RAB9L
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
H00051209-P01-10	RAB9B / RAB9L
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00051209-P01-25	RAB9B / RAB9L
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00051209-Q01-10	RAB9B / RAB9L
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00051209-Q01-25	RAB9B / RAB9L
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.

Catalog No.	Species
H00051209-T01	RAB9B 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
NBL1-15093	RAB9B Lysate

		Novus Biologicals Inc.
LY413988	RAB9B overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH