TA345046 TUBE1 antibody

Rabbit Polyclonal Anti-TUBE1 Antibody - middle region

See related secondary antibodies

Search for all "TUBE1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Porcine, Rabbit, Rat TUBE1

TA345046

More Views

  • TA345046

Product Description for TUBE1

Rabbit anti Equine, Porcine, Rabbit, Rat TUBE1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TUBE1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Epsilon-tubulin, TUBE, Tubulin epsilon chain, epsilon Tubulin
Presentation Purified
Reactivity Eq, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UJT0
Immunogen:
The immunogen for anti-TUBE1 antibody: synthetic peptide directed towards the middle region of human TUBE1. Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA.
GeneID:
51175
Application WB
IHC
Background This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication. This protein plays a central role in organization of the microtubules during centriole duplication. A pseudogene of this gene is found on chromosome 5.[provided by RefSeq, Jan 2009].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TUBE1 (3 products)

Catalog No. Species Pres. Purity   Source  

TUBE1

TUBE1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TUBE1

TUBE1 Human in vitro transl.
  Abnova Taiwan Corp.

TUBE1

TUBE1 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TUBE1 (2 products)

Catalog No. Species Pres. Purity   Source  

Epsilon 1 Tubulin Lysate

Western Blot: Epsilon 1 Tubulin Lysate [NBL1-17443] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TUBE1
  Novus Biologicals Inc.

Tubulin epsilon / TUBE1 Lysate(Denatured)

Tubulin epsilon / TUBE1 Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn