TA345064 GOLGA7 antibody

Rabbit Polyclonal Anti-GOLGA7 Antibody - middle region

See related secondary antibodies

Search for all "GOLGA7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Rabbit, Rat, Zebrafish GOLGA7

Product Description for GOLGA7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Rabbit, Rat, Zebrafish GOLGA7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GOLGA7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GCP16, Golgi complex-associated protein of 16 kDa, Golgi marker, Golgin subfamily A member 7, HDCKB03P, HSPC041
Presentation Purified
Reactivity Bov, Can, Eq, GP, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z5G4
Immunogen:
The immunogen for anti-GOLGA7 antibody: synthetic peptide directed towards the middle region of human GOLGA7. Synthetic peptide located within the following region: ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGL.
GeneID:
51125
Application WB
Background GOLGA7 may be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GOLGA7 (7 products)

Catalog No. Species Pres. Purity   Source  

GOLGA7 (transcript variant 2)

GOLGA7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GOLGA7 (transcript variant 1)

GOLGA7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GOLGA7 (transcript variant 3)

GOLGA7 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GOLGA7 (1-137, His-tag)

GOLGA7 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

GOLGA7 (1-137, His-tag)

GOLGA7 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

GOLGA7

GOLGA7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GOLGA7

GOLGA7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GOLGA7 (3 products)

Catalog No. Species Pres. Purity   Source  

GOLGA7 293T Cell Transient Overexpression Lysate(Denatured)

GOLGA7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GOLGA7 overexpression lysate

GOLGA7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

GOLGA7 overexpression lysate

GOLGA7 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn