TA345068 GLOD4 antibody

Rabbit Polyclonal Anti-GLOD4 Antibody - middle region

See related secondary antibodies

Search for all "GLOD4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rat GLOD4

Product Description for GLOD4

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rat GLOD4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GLOD4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C17orf25, CGI-150, Glyoxalase domain-containing protein 4, My027
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HC38
Immunogen:
The immunogen for anti-GLOD4 antibody: synthetic peptide directed towards the middle region of human GLOD4. Synthetic peptide located within the following region: LAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGG.
GeneID:
51031
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GLOD4 (4 products)

Catalog No. Species Pres. Purity   Source  

GLOD4 (1-298, His-tag)

GLOD4 Human Purified > 95 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

GLOD4 (1-298, His-tag)

GLOD4 Human Purified > 95 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

GLOD4

GLOD4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GLOD4

GLOD4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for GLOD4 (2 products)

Catalog No. Species Pres. Purity   Source  

C17orf25 293T Cell Transient Overexpression Lysate(Denatured)

C17orf25 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GLOD4 overexpression lysate

GLOD4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn