TA345074 TPRKB antibody

Rabbit Polyclonal Anti-TPRKB Antibody - middle region

See related secondary antibodies

Search for all "TPRKB"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish TPRKB

Product Description for TPRKB

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish TPRKB.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TPRKB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CGI-121, My019, PRPK-binding protein, TP53RK-binding protein
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y3C4
Immunogen:
The immunogen for anti-TPRKB antibody: synthetic peptide directed towards the middle region of human TPRKB. Synthetic peptide located within the following region: EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLS.
GeneID:
51002
Application WB
Background Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. TPRKB acts as an allosteric effector that regulates the t(6)A activity of the complex. TPRKB is not required for tR modification.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TPRKB (7 products)

Catalog No. Species Pres. Purity   Source  

TPRKB

TPRKB Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TPRKB (1-175, His-tag)

TPRKB Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

TPRKB (1-175, His-tag)

TPRKB Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

TPRKB

TPRKB Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TPRKB

TPRKB Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TPRKB

TPRKB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TPRKB

TPRKB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TPRKB (3 products)

Catalog No. Species Pres. Purity   Source  

TPRKB 293T Cell Transient Overexpression Lysate(Denatured)

TPRKB 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TPRKB Lysate

Western Blot: TPRKB Lysate [NBL1-17228] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TPRKB
  Novus Biologicals Inc.

TPRKB overexpression lysate

TPRKB overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn