TA345075 MRPL48 antibody

Rabbit Polyclonal Anti-Mrpl48 Antibody - C-terminal region

See related secondary antibodies

Search for all "MRPL48"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat MRPL48

Product Description for MRPL48

Rabbit anti Human, Rat MRPL48.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MRPL48

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 39S ribosomal protein L48, CGI-118, HSPC290, L48mt, MRP-L48, mitochondrial
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96GC5
Immunogen:
The immunogen for Anti-Mrpl48 antibody is: synthetic peptide directed towards the C-terminal region of Rat Mrpl48. Synthetic peptide located within the following region: ISGLSATFAEIFLEILQINLPEGVRLSVREHTEEDFKGRFKARPELEELL.
GeneID:
51642
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MRPL48 (5 products)

Catalog No. Species Pres. Purity   Source  

MRPL48 (full length, N-term HIS tag)

MRPL48 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

MRPL48 (29-212, His-tag)

MRPL48 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

MRPL48 (29-212, His-tag)

MRPL48 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

MRPL48

MRPL48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MRPL48

MRPL48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MRPL48 (2 products)

Catalog No. Species Pres. Purity   Source  

MRPL48 293T Cell Transient Overexpression Lysate(Denatured)

MRPL48 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MRPL48 Lysate

Western Blot: MRPL48 Lysate [NBL1-13275] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for MRPL48.
  Novus Biologicals Inc.
  • LinkedIn