MRPL48

Product Description for MRPL48

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rat MRPL48.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	39S ribosomal protein L48, CGI-118, HSPC290, L48mt, MRP-L48, mitochondrial
Presentation	Purified
Reactivity	Can, GP, Hu, Ms, Por, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Immunogen	Swiss Prot Num: Q96GC5 Immunogen: The immunogen for anti-MRPL48 antibody: synthetic peptide directed towards the middle region of human MRPL48. Synthetic peptide located within the following region: KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK. GeneID: 51642
Application	WB
Background	Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rR composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rR. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 6p. [provided by RefSeq, Jul 2008].
Format	Purification: Affinity Purified Buffer System: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Catalog No.	Species	Pres.	Purity	Source
TP760535	MRPL48 (full length, N-term HIS tag)
	Human		> 80 % Preparation: . Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	E. coli	50 µg / €205.00
					OriGene Technologies, Inc.
AR51659PU-N	MRPL48 (29-212, His-tag)
	Human	Purified	> 85 % by SDS - PAGE	E. coli	0.5 mg / €820.00
					OriGene Technologies GmbH
AR51659PU-S	MRPL48 (29-212, His-tag)
	Human	Purified	> 85 % by SDS - PAGE	E. coli	0.1 mg / €320.00
					OriGene Technologies GmbH
H00051642-P01-10	MRPL48
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00051642-P01-25	MRPL48
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.

Catalog No.	Species
H00051642-T01	MRPL48 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
NBL1-13275	MRPL48 Lysate

		Novus Biologicals Inc.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH