TA345081 OTUD6B / DUBA5 antibody

Rabbit Polyclonal Anti-OTUD6B Antibody - middle region

See related secondary antibodies

Search for all "OTUD6B / DUBA5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Mouse, Porcine, Rabbit, Rat, Zebrafish OTUD6B / DUBA5

Product Description for OTUD6B / DUBA5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Mouse, Porcine, Rabbit, Rat, Zebrafish OTUD6B / DUBA5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for OTUD6B / DUBA5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CGI-77, OTU domain-containing protein 6B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N6M0
Immunogen:
The immunogen for anti-OTUD6B antibody: synthetic peptide directed towards the middle region of human OTUD6B. Synthetic peptide located within the following region: EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC.
GeneID:
51633
Application WB
Background This gene encodes a member of the ovarian tumor domain (OTU)-containing subfamily of deubiquititing enzymes. Deubiquititing enzymes are primarily involved in removing ubiquitin from proteins targeted for degradation. This protein may function as a negative regulator of the cell cycle in B cells. [provided by RefSeq, Nov 2013].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for OTUD6B / DUBA5 (3 products)

Catalog No. Species Pres. Purity   Source  

OTUD6B / DUBA5

OTUD6B / DUBA5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

OTUD6B / DUBA5

OTUD6B / DUBA5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

OTUD6B / DUBA5

OTUD6B / DUBA5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn