TA345082 FAM108B1 antibody

Rabbit Polyclonal Anti-FAM108B1 Antibody - middle region

See related secondary antibodies

Search for all "FAM108B1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Porcine, Rabbit, Zebrafish FAM108B1

Product Description for FAM108B1

Rabbit anti Bovine, Canine, Porcine, Rabbit, Zebrafish FAM108B1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM108B1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Abhydrolase domain-containing protein FAM108B1, C9orf77, CGI-67, chromosome 9 open reading frame 77
Presentation Purified
Reactivity Bov, Can, Por, Rb, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VST6
Immunogen:
The immunogen for anti-FAM108B1 antibody: synthetic peptide directed towards the middle region of human FAM108B1. Synthetic peptide located within the following region: SSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRY.
GeneID:
51104
Application WB
Background FAM108B1 belongs to the AB hydrolase superfamily.fAM108 family. The exact function of FAM108B1 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM108B1 (3 products)

Catalog No. Species Pres. Purity   Source  

FAM108B1 (transcript variant 1)

FAM108B1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FAM108B1

FAM108B1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FAM108B1

FAM108B1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for FAM108B1 (2 products)

Catalog No. Species Pres. Purity   Source  

ABHD17B overexpression lysate

ABHD17B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

FAM108B1 293T Cell Transient Overexpression Lysate(Denatured)

FAM108B1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn