TA345084 UCHL5 antibody

Rabbit Polyclonal Anti-UCHL5 Antibody - middle region

See related secondary antibodies

Search for all "UCHL5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish UCHL5

TA345084

More Views

  • TA345084

Product Description for UCHL5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish UCHL5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UCHL5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AD-019, CGI-70, UCH-L5, UCH37, Ubiquitin C-terminal hydrolase UCH37, Ubiquitin carboxyl-terminal hydrolase isozyme L5, Ubiquitin thioesterase L5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y5K5
Immunogen:
The immunogen for anti-UCHL5 antibody: synthetic peptide directed towards the middle region of human UCHL5. Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK.
GeneID:
51377
Application WB
Background UCHL5 is the deubiquititing enzyme associated with the proteasome.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UCHL5 (8 products)

Catalog No. Species Pres. Purity   Source  

UCHL5

UCHL5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

UCHL5 (1-329, His-tag)

UCHL5 Human Purified > 90 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

UCHL5 (1-329, His-tag)

UCHL5 Human Purified > 90 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

UCHL5

UCHL5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UCHL5

UCHL5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UCHL5

UCHL5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UCHL5

UCHL5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UCHL5

UCHL5 Human
  Abnova Taiwan Corp.

Positive controls for UCHL5 (2 products)

Catalog No. Species Pres. Purity   Source  

UCH37 Lysate

Western Blot: UCH37 Lysate [NBL1-17577] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UCHL5
  Novus Biologicals Inc.

UCHL5 293T Cell Transient Overexpression Lysate(Denatured)

UCHL5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn