TA345086 CUTC antibody

Rabbit Polyclonal Anti-CUTC Antibody - middle region

See related secondary antibodies

Search for all "CUTC"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Guinea Pig, Human, Mouse, Rat, Zebrafish CUTC

Product Description for CUTC

Rabbit anti Canine, Guinea Pig, Human, Mouse, Rat, Zebrafish CUTC.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CUTC

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CGI-32, Copper homeostasis protein cutC homolog
Presentation Purified
Reactivity Can, GP, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NTM9
Immunogen:
The immunogen for anti-CUTC antibody: synthetic peptide directed towards the middle region of human CUTC. Synthetic peptide located within the following region: LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARST.
GeneID:
51076
Application WB
Background Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al., 1995 [PubMed 7635807]; Li et al., 2005 [PubMed 16182249]).[supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combition :: BC028948.1, AF132966.1 [ECO:0000332] Rseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END##
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CUTC (5 products)

Catalog No. Species Pres. Purity   Source  

CUTC

CUTC Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CUTC (1-273, His-tag)

CUTC Human Purified > 95 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

CUTC (1-273, His-tag)

CUTC Human Purified > 95 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

CUTC

CUTC Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CUTC

CUTC Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CUTC (2 products)

Catalog No. Species Pres. Purity   Source  

CUTC 293T Cell Transient Overexpression Lysate(Denatured)

CUTC 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CUTC overexpression lysate

CUTC overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn