TA345095 TRMT6 antibody

Rabbit Polyclonal Anti-TRMT6 Antibody - middle region

See related secondary antibodies

Search for all "TRMT6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TRMT6

Product Description for TRMT6

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TRMT6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRMT6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1153, TRM6, tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit TRM6, tRNA(m1A58)-methyltransferase subunit TRM6, tRNA(m1A58)MTase subunit TRM6
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UJA5
Immunogen:
The immunogen for anti-TRMT6 antibody: synthetic peptide directed towards the middle region of human TRMT6. Synthetic peptide located within the following region: GAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDS.
GeneID:
51605
Application WB
Background This gene encodes a member of the tR methyltransferase 6 protein family. A similar protein in yeast is part of a two component methyltransferase, which is involved in the posttranslatiol modification that produces the modified nucleoside 1-methyladenosine in tRs. Modified 1-methyladenosine influences initiator methionine stability and may be involved in the replication of human immunodeficiency virus type 1. Altertive splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRMT6 (3 products)

Catalog No. Species Pres. Purity   Source  

TRMT6

TRMT6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TRMT6

TRMT6 Human Purified
  Abnova Taiwan Corp.

TRMT6

TRMT6 Human Purified
  Abnova Taiwan Corp.

Positive controls for TRMT6 (2 products)

Catalog No. Species Pres. Purity   Source  

CGI-09 293T Cell Transient Overexpression Lysate(Denatured)

CGI-09 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TRMT6 overexpression lysate

TRMT6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn