TA345099 POP5 (Center) antibody

Rabbit Polyclonal Anti-POP5 Antibody - middle region

See related secondary antibodies

Search for all "POP5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human POP5

Product Description for POP5

Rabbit anti Human POP5.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for POP5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AD-008, HSPC004, Ribonuclease P/MRP protein subunit POP5, x0003
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight POP5: 19 kDa
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q969H6
Immunogen:
Synthetic peptide directed towards the middle region of human POP5
AA Sequence:
KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRR
GeneID:
51367
Property Center
Application Western blotting (0.2 - 1 µg/ml).
Background POP5 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.POP5 is also a component of RNase MRP.
General Readings "hPop5, a protein subunit of the human RNase MRP and RNase P endoribonucleases." van Eenennaam H., Lugtenberg D., Vogelzangs J.H.P., van Venrooij W.J., Pruijn G.J.M. J. Biol. Chem. 276:31635-31641(2001) [PubMed: 11413139]
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse.
Species reactivity (tested):
Human.

Accessory Products

Proteins and/or Positive Controls

Proteins for POP5 (3 products)

Catalog No. Species Pres. Purity   Source  

POP5 (transcript variant 1)

POP5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

POP5

POP5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

POP5

POP5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for POP5 (2 products)

Catalog No. Species Pres. Purity   Source  

POP5 overexpression lysate

POP5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

RPP20 Lysate

Western Blot: RPP20 Lysate [NBL1-14608] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for POP5
  Novus Biologicals Inc.
  • LinkedIn