TA345102 Cytosol aminopeptidase antibody

Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region

See related secondary antibodies

Search for all "Cytosol aminopeptidase"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Rabbit Cytosol aminopeptidase

TA345102

More Views

  • TA345102
  • TA345102
  • TA345102

Product Description for Cytosol aminopeptidase

Rabbit anti Canine, Equine, Human, Rabbit Cytosol aminopeptidase.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cytosol aminopeptidase

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LAP3, LAPEP, Leucine aminopeptidase, Leucine aminopeptidase 3, Leucyl aminopeptidase, PEPS, Peptidase S, Proline aminopeptidase, Prolyl aminopeptidase
Presentation Purified
Reactivity Can, Eq, Hu, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P28838
Immunogen:
The immunogen for anti-LAP3 antibody: synthetic peptide directed towards the N terminal of human LAP3. Synthetic peptide located within the following region: LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN.
GeneID:
51056
Application WB
Background LAP3 is presumably involved in the processing and regular turnover of intracellular proteins. LAP3 catalyzes the removal of unsubstituted N-termil amino acids from various peptides.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Cytosol aminopeptidase (8 products)

Catalog No. Species Pres. Purity   Source  

Cytosol aminopeptidase

Cytosol aminopeptidase Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Cytosol aminopeptidase (1-519, His-tag)

Cytosol aminopeptidase Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €1,070.00
  OriGene Technologies GmbH

Cytosol aminopeptidase (1-519, His-tag)

Cytosol aminopeptidase Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €400.00
  OriGene Technologies GmbH

Cytosol aminopeptidase

Cytosol aminopeptidase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cytosol aminopeptidase

Cytosol aminopeptidase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cytosol aminopeptidase

Cytosol aminopeptidase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Cytosol aminopeptidase

Cytosol aminopeptidase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Cytosol aminopeptidase

Cytosol aminopeptidase Human
  Abnova Taiwan Corp.

Positive controls for Cytosol aminopeptidase (2 products)

Catalog No. Species Pres. Purity   Source  

LAP3 293T Cell Transient Overexpression Lysate(Denatured)

LAP3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LAP3 Lysate

Western Blot: LAP3 Lysate [NBL1-12435] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LAP3
  Novus Biologicals Inc.
  • LinkedIn