TA345105 UBXN1 / SAKS1 antibody

Rabbit Polyclonal Anti-UBXN1 Antibody - middle region

See related secondary antibodies

Search for all "UBXN1 / SAKS1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Goat, Human, Mouse, Rat UBXN1 / SAKS1

Product Description for UBXN1 / SAKS1

Rabbit anti Bovine, Canine, Guinea Pig, Goat, Human, Mouse, Rat UBXN1 / SAKS1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UBXN1 / SAKS1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SAPK substrate protein 1, UBA/UBX 33.3 kDa protein, UBX domain-containing protein 1
Presentation Purified
Reactivity Bov, Can, GP, Gt, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q04323-2
Immunogen:
The immunogen for anti-UBXN1 antibody: synthetic peptide directed towards the middle region of human LOC51035. Synthetic peptide located within the following region: RIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGF.
GeneID:
51035
Application WB
Background Ubiquitin-binding protein that interacts with the BRCA1-BARD1 heterodimer, and regulates its activity. Specifically binds 'Lys-6'-linked polyubiquitin chains. Interaction with autoubiquitited BRCA1, leads to inhibit the E3 ubiquitin-protein ligase activity of the BRCA1-BARD1 heterodimer. Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn