TA345109 Gemin-4 antibody

Rabbit Polyclonal Anti-GEMIN4 Antibody - N-terminal region

See related secondary antibodies

Search for all "Gemin-4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit Gemin-4

Product Description for Gemin-4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit Gemin-4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Gemin-4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Component of gems 4, GEMIN4, p97
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P57678
Immunogen:
The immunogen for anti-GEMIN4 antibody: synthetic peptide directed towards the N terminal of human GEMIN4. Synthetic peptide located within the following region: QALAEKVKEAERDVSLTSLAKLPSETIFVGCEFLHHLLREWGEELQAVLR.
GeneID:
50628
Application WB
Background The product of this gene is part of a large complex localized to the cytoplasm, nucleoli, and to discrete nuclear bodies called Gemini bodies (gems). The complex functions in spliceosomal snRNP assembly in the cytoplasm, and regenerates spliceosomes required for pre-mR splicing in the nucleus. The encoded protein directly interacts with a DEAD box protein and several spliceosome core proteins. Altertively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Gemin-4 (2 products)

Catalog No. Species Pres. Purity   Source  

Gemin-4

Gemin-4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Gemin-4

Gemin-4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn