TA345124 UBL3 / MUB antibody

Rabbit Polyclonal Anti-UBL3 Antibody - C-terminal region

See related secondary antibodies

Search for all "UBL3 / MUB"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish UBL3 / MUB

Product Description for UBL3 / MUB

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish UBL3 / MUB.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UBL3 / MUB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Membrane-anchored ubiquitin-fold protein, PNSC1, Protein HCG-1, Ubiquitin-like protein 3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95164
Immunogen:
The immunogen for anti-Ubl3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCV.
GeneID:
5412
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UBL3 / MUB (5 products)

Catalog No. Species Pres. Purity   Source  

UBL3 / MUB

UBL3 / MUB Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

UBL3 / MUB (1-114, His-tag)

UBL3 / MUB Human Purified > 90 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

UBL3 / MUB (1-114, His-tag)

UBL3 / MUB Human Purified > 90 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

UBL3 / MUB

UBL3 / MUB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UBL3 / MUB

UBL3 / MUB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for UBL3 / MUB (1 products)

Catalog No. Species Pres. Purity   Source  

UBL3 Lysate

Western Blot: UBL3 Lysate [NBL1-17553] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UBL3
  Novus Biologicals Inc.
  • LinkedIn