TA345128 RPE antibody

Rabbit Polyclonal Anti-RPE Antibody - N-terminal region

See related secondary antibodies

Search for all "RPE"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish RPE

TA345128

More Views

  • TA345128

Product Description for RPE

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish RPE.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RPE

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HUSSY-17, Ribulose-5-phosphate-3-epimerase, Ribulose-phosphate 3-epimerase
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96AT9
Immunogen:
The immunogen for anti-RPE antibody: synthetic peptide directed towards the N terminal of human RPE. Synthetic peptide located within the following region: ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ.
GeneID:
6120
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RPE (5 products)

Catalog No. Species Pres. Purity   Source  

RPE (transcript variant 1)

RPE Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RPE (1-228, His-tag)

RPE Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

RPE (1-228, His-tag)

RPE Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

RPE

RPE Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RPE

RPE Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RPE (4 products)

Catalog No. Species Pres. Purity   Source  

RPE 293T Cell Transient Overexpression Lysate(Denatured)

RPE 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RPE 293T Cell Transient Overexpression Lysate(Denatured)

RPE 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RPE Lysate

Western Blot: RPE Lysate [NBL1-15494] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RPE
  Novus Biologicals Inc.

RPE overexpression lysate

RPE overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn