TA345132 PSMC4 / TBP7 antibody

Rabbit Polyclonal Anti-PSMC4 Antibody - N-terminal region

See related secondary antibodies

Search for all "PSMC4 / TBP7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human, Mouse, Rabbit, Zebrafish PSMC4 / TBP7

TA345132

More Views

  • TA345132

Product Description for PSMC4 / TBP7

Rabbit anti Equine, Human, Mouse, Rabbit, Zebrafish PSMC4 / TBP7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PSMC4 / TBP7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 26S protease regulatory subunit 6B, MB67-interacting protein, MIP224, Proteasome 26S subunit ATPase 4, TBP-7, Tat-binding protein 7
Presentation Purified
Reactivity Eq, Hu, Ms, Rb, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P43686
Immunogen:
The immunogen for anti-PSMC4 antibody: synthetic peptide directed towards the N terminal of human PSMC4. Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE.
GeneID:
5704
Application WB
Background The 26S proteasome is a multicatalytic proteise complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the triple-A family of ATPases that is a component of the 19S regulatory subunit and plays a role in 26S proteasome assembly. The encoded protein interacts with gankyrin, a liver oncoprotein, and may also play a role in Parkinson's disease through interactions with synphilin-1. Altertively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PSMC4 / TBP7 (3 products)

Catalog No. Species Pres. Purity   Source  

PSMC4 / TBP7 (transcript variant 1)

PSMC4 / TBP7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PSMC4 / TBP7

PSMC4 / TBP7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PSMC4 / TBP7

PSMC4 / TBP7 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PSMC4 / TBP7 (4 products)

Catalog No. Species Pres. Purity   Source  

PSMC4 293T Cell Transient Overexpression Lysate(Denatured)

PSMC4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PSMC4 overexpression lysate

PSMC4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Tbp7 Lysate

Western Blot: Tbp7 Lysate [NBL1-14890] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PSMC4
  Novus Biologicals Inc.

Tbp7 Lysate

Western Blot: Tbp7 Lysate [NBL1-14891] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PSMC4
  Novus Biologicals Inc.
  • LinkedIn