TA345142 PPP2R5E antibody

Rabbit Polyclonal Anti-PPP2R5E Antibody - N-terminal region

See related secondary antibodies

Search for all "PPP2R5E"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish PPP2R5E

Product Description for PPP2R5E

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish PPP2R5E.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PPP2R5E

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PP2A B subunit B'epsilon isoform, PP2A B subunit B56 epsilon isoform, PP2A B subunit PR61 epsilon isoform, PP2A B subunit R5 epsilon isoform, Protein phosphatase 2A, Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q16537
Immunogen:
The immunogen for anti-PPP2R5E antibody: synthetic peptide directed towards the N terminal of human PPP2R5E. Synthetic peptide located within the following region: QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK.
GeneID:
5529
Application WB
Background The protein encoded by this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an epsilon isoform of the regulatory subunit B56 subfamily. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Aug 2013].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PPP2R5E (4 products)

Catalog No. Species Pres. Purity   Source  

PPP2R5E

PPP2R5E Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PPP2R5E

PPP2R5E Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PPP2R5E

PPP2R5E Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PPP2R5E

PPP2R5E Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PPP2R5E (1 products)

Catalog No. Species Pres. Purity   Source  

PPP2R5E 293T Cell Transient Overexpression Lysate(Denatured)

PPP2R5E 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn