TA345143 Nociceptin antibody

Rabbit Polyclonal Anti-PNOC Antibody - middle region

See related secondary antibodies

Search for all "Nociceptin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish Nociceptin

Product Description for Nociceptin

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish Nociceptin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Nociceptin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Pnoc
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13519
Immunogen:
The immunogen for anti-PNOC antibody: synthetic peptide directed towards the middle region of human PNOC. Synthetic peptide located within the following region: EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY.
GeneID:
5368
Application WB
Background Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neurol differentiation and development.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Nociceptin (6 products)

Catalog No. Species Pres. Purity   Source  

Nociceptin (20-176, His-tag)

Nociceptin Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

Nociceptin (20-176, His-tag)

Nociceptin Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

Nociceptin

Nociceptin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Nociceptin

Nociceptin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Nociceptin

Nociceptin Human
  Abnova Taiwan Corp.

Nociceptin

Nociceptin Human
  Abnova Taiwan Corp.

Positive controls for Nociceptin (2 products)

Catalog No. Species Pres. Purity   Source  

Nociceptin Lysate

Western Blot: Nociceptin Lysate [NBL1-14553] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for PNOC.
  Novus Biologicals Inc.

PNOC overexpression lysate

PNOC overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn