TA345157 Proenkephalin-A (PENK) antibody

Rabbit Polyclonal Anti-PENK Antibody - middle region

See related secondary antibodies

Search for all "Proenkephalin-A (PENK)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Proenkephalin-A (PENK)

Product Description for Proenkephalin-A (PENK)

Rabbit anti Human Proenkephalin-A (PENK).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Proenkephalin-A (PENK)

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P01210
Immunogen:
The immunogen for anti-PENK antibody: synthetic peptide directed towards the middle region of human PENK. Synthetic peptide located within the following region: DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG.
GeneID:
5179
Application WB
Background Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress. PENK(114-133) and PENK(237-258) increase glutamate release in the striatum. PENK(114-133) decreases GABA concentration in the striatum.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Proenkephalin-A (PENK) (4 products)

Catalog No. Species Pres. Purity   Source  

Proenkephalin-A (PENK) (transcript variant 1)

Proenkephalin-A (PENK) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Proenkephalin-A (PENK)

Proenkephalin-A (PENK) Human
  Abnova Taiwan Corp.

Proenkephalin-A (PENK)

Proenkephalin-A (PENK) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Proenkephalin-A (PENK)

Proenkephalin-A (PENK) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Proenkephalin-A (PENK) (1 products)

Catalog No. Species Pres. Purity   Source  

Enkephalin Lysate

Enkephalin Lysate
  Novus Biologicals Inc.
  • LinkedIn