TA345158 PDE4D antibody

Rabbit Polyclonal Anti-PDE4D Antibody - C-terminal region

See related secondary antibodies

Search for all "PDE4D"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PDE4D

Product Description for PDE4D

Rabbit anti Human PDE4D.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PDE4D

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 5'-cyclic phosphodiesterase 4D, DPDE3, EC=3.1.4.17, PDE43, PDE4D, cAMP-specific 3'
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q08499
Immunogen:
The immunogen for Anti-PDE4D antibody is: synthetic peptide directed towards the C-terminal region of Human PDE4D. Synthetic peptide located within the following region: FQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQ.
GeneID:
5144
Application WB
Background This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3',5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a sigl transduction molecule in multiple cell types. This gene uses different promoters to generate multiple altertively spliced transcript variants that encode functiol proteins.[provided by RefSeq, Sep 2009].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PDE4D (6 products)

Catalog No. Species Pres. Purity   Source  

PDE4D (transcript variant 2)

PDE4D Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PDE4D

PDE4D Human
  Abnova Taiwan Corp.

PDE4D

PDE4D Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PDE4D

PDE4D Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PDE4D

PDE4D Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PDE4D

PDE4D Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for PDE4D (4 products)

Catalog No. Species Pres. Purity   Source  

PDE4D overexpression lysate

PDE4D overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

PDE4D overexpression lysate

PDE4D overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

PDE4D overexpression lysate

PDE4D overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

Phosphodiesterase 4D Lysate

Western Blot: Phosphodiesterase 4D Lysate [NBL1-14223] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for PDE4D.
  Novus Biologicals Inc.
  • LinkedIn