TA345160 ORC2 antibody

Rabbit Polyclonal Anti-ORC2 Antibody - C-terminal region

See related secondary antibodies

Search for all "ORC2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse ORC2

Product Description for ORC2

Rabbit anti Human, Mouse ORC2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ORC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ORC2L, Origin recognition complex 71 kDa subunit, Origin recognition complex subunit 2, RRR1, SIR5, YBR0523, YBR060C
Presentation Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13416
Immunogen:
The immunogen for Anti-Orc2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Orc2. Synthetic peptide located within the following region: LMWDHAKQSLYNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLIHV.
GeneID:
4999
Application WB
Background Component of the origin recognition complex (ORC) that binds origins of replication. D-binding is ATP-dependent. The specific D sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate D replication (By similarity). Binds histone H3 and H4 trimethylation marks H3K9me3, H3K20me3 and H4K27me3. Stabilizes LRWD1, by protecting it from ubiquitin-mediated proteasomal degradation. Also stabilizes ORC3.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ORC2 (4 products)

Catalog No. Species Pres. Purity   Source  

ORC2

ORC2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ORC2

ORC2 Human in vitro transl.
  Abnova Taiwan Corp.

ORC2

ORC2 Human in vitro transl.
  Abnova Taiwan Corp.

ORC2

ORC2 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ORC2 (1 products)

Catalog No. Species Pres. Purity   Source  

Orc2 Lysate

Western Blot: Orc2 Lysate [NBL1-13973] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ORC2L
  Novus Biologicals Inc.
  • LinkedIn