TA345175 ZNF793 antibody

Rabbit Polyclonal Anti-ZNF793 Antibody

See related secondary antibodies

Search for all "ZNF793"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat ZNF793

Product Description for ZNF793

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat ZNF793.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF793

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZN11
Immunogen:
The immunogen for Anti-ZNF793 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF793. Synthetic peptide located within the following region: KDVVVGFTQEEWHRLSPAQRALYRDVMLETYSNLASVGYEGTKPDVILRL.
GeneID:
390927
Application WB
Background ZNF793 may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn