TA345186 TGFB1I1 antibody

Rabbit Polyclonal Anti-TGFB1I1 Antibody

See related secondary antibodies

Search for all "TGFB1I1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Rabbit, Rat TGFB1I1

TA345186

More Views

  • TA345186

Product Description for TGFB1I1

Rabbit anti Canine, Equine, Human, Mouse, Rabbit, Rat TGFB1I1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TGFB1I1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ARA55, Androgen receptor-associated protein of 55 kDa, HIC-5, Hydrogen peroxide-inducible clone 5 protein, Transforming growth factor beta-1-induced transcript 1 protein
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43294
Immunogen:
The immunogen for anti-TGFB1I1 antibody: synthetic peptide directed towards the N terminal of human TGFB1I1. Synthetic peptide located within the following region: PRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRS.
GeneID:
7041
Application WB
IHC
Background The TGFB1I1 gene encodes a protein that is a key element in the transduction of sigls from the cell surface to the nucleus under oxidative stress-review. Higher gene expression may result in unfavorable recurrence-free survival and overall survival in hormone-refractory prostate cancer.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TGFB1I1 (4 products)

Catalog No. Species Pres. Purity   Source  

TGFB1I1 (transcript variant 2)

TGFB1I1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TGFB1I1 (transcript variant 3)

TGFB1I1 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TGFB1I1

TGFB1I1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TGFB1I1

TGFB1I1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TGFB1I1 (2 products)

Catalog No. Species Pres. Purity   Source  

HIC5 Lysate

Western Blot: HIC5 Lysate [NBL1-16853] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TGFB1I1
  Novus Biologicals Inc.

TGFB1I1 293T Cell Transient Overexpression Lysate(Denatured)

TGFB1I1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn