TA345196 ZNF580 antibody

Rabbit Polyclonal Anti-ZNF580 Antibody

See related secondary antibodies

Search for all "ZNF580"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat ZNF580

TA345196

More Views

  • TA345196

Product Description for ZNF580

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat ZNF580.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZNF580

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein 580
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UK33
Immunogen:
The immunogen for anti-ZNF580 antibody: synthetic peptide directed towards the N terminal of human ZNF580. Synthetic peptide located within the following region: KAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQRE.
GeneID:
51157
Application WB
IHC
Background ZNF580 may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF580 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF580 (transcript variant 2)

ZNF580 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZNF580 (transcript variant 1)

ZNF580 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZNF580 (transcript variant 3)

ZNF580 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for ZNF580 (5 products)

Catalog No. Species Pres. Purity   Source  

ZNF580 Lysate

Western Blot: ZNF580 Lysate [NBL1-18196] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF580
  Novus Biologicals Inc.

ZNF580 overexpression lysate

ZNF580 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ZNF580 overexpression lysate

ZNF580 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ZNF580 overexpression lysate

ZNF580 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

ZNF580 overexpression lysate

ZNF580 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn