TA345199 WBP5 antibody

Rabbit Polyclonal Anti-WBP5 Antibody

See related secondary antibodies

Search for all "WBP5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Porcine, Rabbit, Rat WBP5

Product Description for WBP5

Rabbit anti Bovine, Equine, Human, Porcine, Rabbit, Rat WBP5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for WBP5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms WW domain-binding protein 5
Presentation Purified
Reactivity Bov, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UHQ7
Immunogen:
The immunogen for anti-WBP5 antibody: synthetic peptide directed towards the middle region of human WBP5. Synthetic peptide located within the following region: TFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWK.
GeneID:
51186
Application WB
Background The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and sigling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Altertive splicing results in multiple transcript variants encoding a single isoform.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for WBP5 (1 products)

Catalog No. Species Pres. Purity   Source  

WBP5 (transcript variant 1)

WBP5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for WBP5 (8 products)

Catalog No. Species Pres. Purity   Source  

WBP5 overexpression lysate

WBP5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

WBP5 overexpression lysate

WBP5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

WBP5 overexpression lysate

WBP5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

WBP5 overexpression lysate

WBP5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

WBP5 overexpression lysate

WBP5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

WBP5 overexpression lysate

WBP5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

WBP5 overexpression lysate

WBP5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

WW domain binding protein 5 Lysate

Western Blot: WW domain binding protein 5 Lysate [NBL1-17783] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for WBP5
  Novus Biologicals Inc.
  • LinkedIn