TA345201 TCEA1 / TFIIS antibody

Rabbit Polyclonal Anti-Tcea1 Antibody

See related secondary antibodies

Search for all "TCEA1 / TFIIS"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish TCEA1 / TFIIS

Product Description for TCEA1 / TFIIS

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish TCEA1 / TFIIS.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TCEA1 / TFIIS

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GTF2S, Transcription elongation factor A protein 1, Transcription elongation factor S-II protein 1, Transcription elongation factor TFIIS.o
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q4KLL0
Immunogen:
The immunogen for anti-Tcea1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: AKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKF.
GeneID:
362479
Application WB
Background Tcea1 is necessary for efficient R polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in D have the property of trapping a certain fraction of elongating R polymerases that pass through, resulting in locked terry complexes. Cleavage of the scent transcript by S-II allows the resumption of elongation from the new 3'-terminus.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn