TA345203 GTF2IRD1 / CREAM1 antibody

Rabbit Polyclonal Anti-GTF2IRD1 Antibody

See related secondary antibodies

Search for all "GTF2IRD1 / CREAM1"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat GTF2IRD1 / CREAM1

TA345203

More Views

  • TA345203

Product Description for GTF2IRD1 / CREAM1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat GTF2IRD1 / CREAM1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for GTF2IRD1 / CREAM1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GTF2I repeat domain-containing protein 1, GTF2I repeat domain-containing protein 1, GTF3, General transcription factor II-I repeat domain-containing protein 1, General transcription factor III, MUSTRD1, MusTRD1/BEN, Muscle TFII-I repeat domain-containing protein 1, RBAP2, Slow-muscle-fiber enhancer-binding protein, USE B1-binding protein, WBSCR11, WBSCR12, Williams-Beuren syndrome chromosomal region 11 protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UHL9
Immunogen:
The immunogen for anti-GTF2IRD1 antibody: synthetic peptide directed towards the N terminal of human GTF2IRD1. Synthetic peptide located within the following region: MALLGKRCDVPTNGCGPDRWNSAFTRKDEIITSLVSALDSMCSALSKLNA.
GeneID:
9569
Application WB
IHC
Background GTF2IRD1 contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptiol regulator under the control of Retinoblastoma protein. GTF2IRD1 is related to Williams-Beuren syndrome, a multisystem developmental disorder. Western blots using three different antibodies against three unique regions of this protein target confirm the same apparent molecular weight in our tests. The protein encoded by this gene contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptiol regulator under the control of Retinoblastoma protein. This gene is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by deletion of multiple genes at 7q11.23. Altertive splicing of this gene generates at least 2 transcript variants.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GTF2IRD1 / CREAM1 (8 products)

Catalog No. Species Pres. Purity   Source  

GTF2IRD1 / CREAM1 (transcript variant 1)

GTF2IRD1 / CREAM1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

GTF2IRD1 / CREAM1 (transcript variant 2)

GTF2IRD1 / CREAM1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

GTF2IRD1 / CREAM1

GTF2IRD1 / CREAM1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GTF2IRD1 / CREAM1

GTF2IRD1 / CREAM1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GTF2IRD1 / CREAM1

GTF2IRD1 / CREAM1 Human Purified
  Abnova Taiwan Corp.

GTF2IRD1 / CREAM1

GTF2IRD1 / CREAM1 Human Purified
  Abnova Taiwan Corp.

GTF2IRD1 / CREAM1

GTF2IRD1 / CREAM1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GTF2IRD1 / CREAM1

GTF2IRD1 / CREAM1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GTF2IRD1 / CREAM1 (6 products)

Catalog No. Species Pres. Purity   Source  

GTF2IRD1 293T Cell Transient Overexpression Lysate(Denatured)

GTF2IRD1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GTF2IRD1 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

GTF2IRD1 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-GTF2IRD1 antibody (H00009569-M01) by Western Blots.
  Abnova Taiwan Corp.

GTF2IRD1 Lysate

Western Blot: GTF2IRD1 Lysate [NBL1-11393] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GTF2IRD1
  Novus Biologicals Inc.

GTF2IRD1 overexpression lysate

GTF2IRD1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

GTF2IRD1 overexpression lysate

GTF2IRD1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

GTF2IRD1 overexpression lysate

GTF2IRD1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn