TA345206 KLF3 antibody

Rabbit Polyclonal Anti-Klf3 Antibody

See related secondary antibodies

Search for all "KLF3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KLF3

Product Description for KLF3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KLF3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KLF3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BKLF, Basic krueppel-like factor, CACCC-box-binding protein BKLF, KLF3, Krueppel-like factor 3, TEF-2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q60980
Immunogen:
The immunogen for Anti-Klf3 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Klf3. Synthetic peptide located within the following region: MLMFDPVPVKQEAMDPVSVSFPSNYIESMKPNKYGVIYSTPLPDKFFQTP.
GeneID:
16599
Application WB
Background Klf3 binds to the CACCC box of erythroid cell-expressed genes. It may play a role in hematopoiesis.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn