TA345207 ERGIC2 antibody

Rabbit Polyclonal Anti-ERGIC2 Antibody

See related secondary antibodies

Search for all "ERGIC2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ERGIC2

Product Description for ERGIC2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ERGIC2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ERGIC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CDA14, ERV41, Endoplasmic reticulum-Golgi intermediate compartment protein 2, PTX1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96RQ1
Immunogen:
The immunogen for anti-ERGIC2 antibody: synthetic peptide directed towards the N terminal of human ERGIC2. Synthetic peptide located within the following region: MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIAFTTMALLTIM.
GeneID:
51290
Application WB
Background ERGIon Channel2 possibly play role in transport between endoplasmic reticulum and Golgi. ERGIon Channel2 is downregulated in prostate cancer. ERGIon Channel2 may play an important role in the growth and tumorigenicity of PC-3 prostate tumor cells. Ectopic expression of a partial sequence of ERGIon Channel2 as a VP22-fusion protein in prostate cancer cell line, PC-3, induced cellular senescence. Interferon-beta (IFN-beta) and a number of IFN-inducible genes were upregulated by the ERGIon Channel2-VP22 fusion protein.
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ERGIC2 (2 products)

Catalog No. Species Pres. Purity   Source  

ERGIC2

ERGIC2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ERGIC2

ERGIC2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ERGIC2 (1 products)

Catalog No. Species Pres. Purity   Source  

ERGIC2 Lysate

Western Blot: ERGIC2 Lysate [NBL1-10330] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ERGIC2
  Novus Biologicals Inc.
  • LinkedIn