TA345210 PHF21A antibody

Rabbit Polyclonal Anti-PHF21A Antibody

See related secondary antibodies

Search for all "PHF21A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PHF21A

TA345210

More Views

  • TA345210
  • TA345210
  • TA345210

Product Description for PHF21A

Rabbit anti Canine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PHF21A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PHF21A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BHC80, BHC80a, BM-006, BRAF35-HDAC complex protein BHC80, KIAA1696, PHD finger protein 21A
Presentation Purified
Reactivity Can, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96BD5
Immunogen:
The immunogen for anti-PHF21A antibody: synthetic peptide directed towards the N terminal of human PHF21A. Synthetic peptide located within the following region: MELQTLQEALKVEIQVHQKLVAQMKQDPQNADLKKQLHELQAKITALSEK.
GeneID:
51317
Application WB
Background PHF21A (BHC80) is a component of a BRAF35/histone deacetylase complex (BHC) that mediates repression of neuron-specific genes through the cis-regulatory element known as repressor element-1 (RE1) or neural restrictive silencer (NRS). BHC80 is a component of a BRAF35 (MIM 605535)/histone deacetylase (HDAC; see MIM 601241) complex (BHC) that mediates repression of neuron-specific genes through the cis-regulatory element known as repressor element-1 (RE1) or neural restrictive silencer (NRS) (Hakimi et al., 2002 [PubMed 12032298]).[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PHF21A (2 products)

Catalog No. Species Pres. Purity   Source  

PHF21A

PHF21A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PHF21A

PHF21A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PHF21A (2 products)

Catalog No. Species Pres. Purity   Source  

PHF21A Lysate

Western Blot: PHF21A Lysate [NBL1-14357] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PHF21A
  Novus Biologicals Inc.

PHF21A overexpression lysate

PHF21A overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn