TA345213 HOXC10 / HOX3I antibody

Rabbit Polyclonal Anti-HOXC10 Antibody

See related secondary antibodies

Search for all "HOXC10 / HOX3I"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat HOXC10 / HOX3I

TA345213

More Views

  • TA345213

Product Description for HOXC10 / HOX3I

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat HOXC10 / HOX3I.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for HOXC10 / HOX3I

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein Hox-C10, Hox-3I
Presentation Purified
Reactivity Can, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NYD6
Immunogen:
The immunogen for anti-HOXC10 antibody: synthetic peptide directed towards the N terminal of human HOXC10. Synthetic peptide located within the following region: MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLA.
GeneID:
3226
Application WB
IHC
Background HOXC10 belongs to the homeobox family. The homeobox family is a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HOXC10 / HOX3I (2 products)

Catalog No. Species Pres. Purity   Source  

HOXC10 / HOX3I

HOXC10 / HOX3I Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HOXC10 / HOX3I

HOXC10 / HOX3I Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for HOXC10 / HOX3I (1 products)

Catalog No. Species Pres. Purity   Source  

HOXC10 Lysate

Western Blot: HOXC10 Lysate [NBL1-11675] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for HOXC10.
  Novus Biologicals Inc.
  • LinkedIn